PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT19303
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family Nin-like
Protein Properties Length: 334aa    MW: 35581.1 Da    PI: 8.4721
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT19303genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK76.43.2e-244391452
    RWP-RK  4 eisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52
              ++s e++sk Fslpi++AA+ Lgvc++vLKriCR +GI RWP+Rk+ksl
  EMT19303 43 SLSYEEISKLFSLPIAEAASILGVCTSVLKRICRTHGIVRWPYRKVKSL 91
              6899*******************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151916.46127112IPR003035RWP-RK domain
PfamPF020424.3E-224491IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 334 aa     Download sequence    Send to blast
MAASAQELPP AQQQPAAEQP PSLALALVPQ PQAQAQIKPT RVSLSYEEIS KLFSLPIAEA  60
ASILGVCTSV LKRICRTHGI VRWPYRKVKS LSVLRLGSLV HVAPACSGPV EGSDHFGSFI  120
VSGKGDDAKN AEREKAMQLL ELSKIAKQKA ISSSGSLATS SSGAFQGVPK AQQGSAKAGS  180
AIGRQNAPSL SQFSQAKDIP TYMDDFKYGF PSSGLSTETM KWWGTDSHTE TAPAKDDNRE  240
GSESTNEASK GMTDDELDWG ADEPEADADG VAAATDPSAQ LCFLRRKAAG DGRRLLNGDT  300
GRVQQLCRLN KRQKIVLAQV FGASLPEQWR SKLA
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3709800.0AK370980.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2121H22.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010230688.11e-138PREDICTED: uncharacterized protein LOC104582530
TrEMBLR7WBV30.0R7WBV3_AEGTA; Uncharacterized protein
STRINGBRADI2G08600.11e-138(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP67053242
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35590.15e-11RWP-RK domain-containing protein